PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10003315m
Common NameEUTSA_v10003315mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 267aa    MW: 30593 Da    PI: 6.8973
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10003315mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.87.6e-15542441
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                     +n++  q tfskRr  ++KK +ELS+LC+a++a+i++ 
  Thhalv10003315m  5 KNETSLQDTFSKRRSELFKKTSELSTLCGAKIAIIVYL 42
                     78889999****************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-12153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.848154IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-18269IPR002100Transcription factor, MADS-box
PfamPF003191.3E-17450IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-61631IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-63152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MVKMKNETSL QDTFSKRRSE LFKKTSELST LCGAKIAIIV YLPGRKAFSF DHPNVETIID  60
RFLNNNSPPP HQPNNLQPSE AHQNYIIQDL NNHLTQVMNQ LESEKEKKNE ELKKIRENSK  120
MPENWREKPI EGLDLAQAYK FKGMLEILKK KSNSPHPNFD VRSTSNAPFG VDDGSNNFHV  180
GNPSNASFGI SGGNIYFHVG NSSNDLFGID GSNKINLDFD HITNEFVPRN NMNYIPEFNR  240
NHIMTLNEEN EHHHDSHPPH YRSDYF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403216.10.0hypothetical protein EUTSA_v10003315mg
SwissprotQ9FKK22e-70AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLV4LLQ80.0V4LLQ8_EUTSA; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_80020414e-75(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-53AGAMOUS-like 62